SCOP 1.63: Domain d1lixb3: 1lix B:440-573

Lineage for d1lixb3 (1lix B:440-573)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)

6. Protein Pyruvate kinase, C-terminal domain [52937] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)

8. Domain d1lixb3: 1lix B:440-573 [77999]
   Other proteins in same PDB: d1lixa1, d1lixa2, d1lixb1, d1lixb2, d1lixc1, d1lixc2, d1lixd1, d1lixd2

Details for d1lixb3

PDB Entry: 1lix, 2.87 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant

SCOP Domain Sequences for d1lixb3:

Sequence; same for both SEQRES and ATOM records:

>d1lixb3 c.49.1.1 (B:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens)}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllswyrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

Timeline for d1lixb3:

• d1lixb3 is new in SCOP 1.63
  
• d1lixb3 appears in SCOP 1.65
  
• d1lixb3 last appears in SCOP 1.75