SCOP 1.75: Domain d1liud3: 1liu D:440-573

Lineage for d1liud3 (1liu D:440-573)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)

6. Protein Pyruvate kinase, C-terminal domain [52937] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82431] (4 PDB entries)

8. Domain d1liud3: 1liu D:440-573 [77981]
   Other proteins in same PDB: d1liua1, d1liua2, d1liub1, d1liub2, d1liuc1, d1liuc2, d1liud1, d1liud2
   complexed with fbp, k, mn, pga

Details for d1liud3

PDB Entry: 1liu, 2.72 Å

PDB Description: Human erythrocyte pyruvate kinase

PDB Compounds: (D:) Pyruvate kinase, isozymes R/L

SCOP Domain Sequences for d1liud3:

Sequence; same for both SEQRES and ATOM records:

>d1liud3 c.49.1.1 (D:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrs
aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr
pgsgytnimrvlsi

Timeline for d1liud3:

• d1liud3 first appeared in SCOP 1.63
  
• d1liud3 appears in SCOP 1.73
  
• d1liud3 does not appear in SCOPe 2.01