Lineage for d1li0a_ (1li0 A:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266132Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 266133Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 266134Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)
  6. 266203Protein beta-Lactamase, class A [56606] (13 species)
  7. 266218Species Escherichia coli, TEM-1 [TaxId:562] [56607] (21 PDB entries)
  8. 266221Domain d1li0a_: 1li0 A: [77968]
    TEM-32 variant
    complexed with bct, k; mutant

Details for d1li0a_

PDB Entry: 1li0 (more details), 1.61 Å

PDB Description: Crystal structure of TEM-32 beta-Lactamase at 1.6 Angstrom
PDB Compounds: (A:)

SCOP Domain Sequences for d1li0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1li0a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmistfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOP Domain Coordinates for d1li0a_:

Click to download the PDB-style file with coordinates for d1li0a_.
(The format of our PDB-style files is described here.)

Timeline for d1li0a_: