SCOP 1.63: Domain d1lfwa1: 1lfw A:1-186,A:383-468

Lineage for d1lfwa1 (1lfw A:1-186,A:383-468)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (4 proteins)

6. Protein Aminopeptidase PepV [82450] (1 species)
   unspecific amino dipeptidase

7. Species Lactobacillus delbrueckii [82451] (1 PDB entry)

8. Domain d1lfwa1: 1lfw A:1-186,A:383-468 [77942]
   Other proteins in same PDB: d1lfwa2
   complexed with aep, zn

Details for d1lfwa1

PDB Entry: 1lfw, 1.8 Å

PDB Description: Crystal structure of pepV

SCOP Domain Sequences for d1lfwa1:

Sequence; same for both SEQRES and ATOM records:

>d1lfwa1 c.56.5.4 (A:1-186,A:383-468) Aminopeptidase PepV {Lactobacillus delbrueckii}
mdlnfkelaeakkdailkdleeliaidssedlenateeypvgkgpvdamtkflsfakrdg
fdtenfanyagrvnfgagdkrlgiighmdvvpagegwtrdpfkmeideegriygrgsadd
kgpsltayygmlllkeagfkpkkkidfvlgtneetnwvgidyylkheptpdivfspdaey
piingeXhyvpgsdpmvqtllkvyekqtgkpghevvigggtygrlfergvafgaqpengp
mvmhaanefmmlddlilsiaiyaeaiyeltkde

Timeline for d1lfwa1:

• d1lfwa1 is new in SCOP 1.63
  
• d1lfwa1 appears in SCOP 1.65
  
• d1lfwa1 appears in the current release, SCOPe 2.08