Lineage for d1lf0a_ (1lf0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1362957Protein cH-p21 Ras protein [52593] (1 species)
  7. 1362958Species Human (Homo sapiens) [TaxId:9606] [52594] (100 PDB entries)
    Uniprot Q6P716
  8. 1362993Domain d1lf0a_: 1lf0 A: [77913]
    complexed with ca, gnp, mg

Details for d1lf0a_

PDB Entry: 1lf0 (more details), 1.7 Å

PDB Description: crystal structure of rasa59g in the gtp-bound form
PDB Compounds: (A:) transforming protein p21/h-ras-1

SCOPe Domain Sequences for d1lf0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lf0a_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d1lf0a_:

Click to download the PDB-style file with coordinates for d1lf0a_.
(The format of our PDB-style files is described here.)

Timeline for d1lf0a_: