SCOPe 2.03: Domain d1lb2b_: 1lb2 B:

Lineage for d1lb2b_ (1lb2 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)

6. Protein C-terminal domain of RNA polymerase alpha subunit [47791] (3 species)

7. Species Escherichia coli [TaxId:562] [47792] (2 PDB entries)

8. Domain d1lb2b_: 1lb2 B: [77871]
   Other proteins in same PDB: d1lb2a1, d1lb2a2
   protein/DNA complex; protein/RNA complex; complexed with cmp

Details for d1lb2b_

PDB Entry: 1lb2, 3.1 Å

PDB Description: Structure of the E. coli alpha C-terminal domain of RNA polymerase in complex with CAP and DNA

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1lb2b_:

Sequence; same for both SEQRES and ATOM records:

>d1lb2b_ a.60.3.1 (B:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas
rglslgmrlenw

Timeline for d1lb2b_:

• d1lb2b_ first appeared in SCOP 1.63
  
• d1lb2b_ appears in SCOPe 2.02
  
• d1lb2b_ appears in SCOPe 2.04
  
• d1lb2b_ appears in the current release, SCOPe 2.08