SCOP 1.65: Domain d1lajc_: 1laj C:

Lineage for d1lajc_ (1laj C:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families)

5. Family b.121.4.5: Bromoviridae-like VP [88639] (1 protein)

6. Protein Cucumovirus coat protein [88640] (4 species)

7. Species TAV (Tomato aspermy virus) [TaxId:12315] [82012] (1 PDB entry)

8. Domain d1lajc_: 1laj C: [77867]
   complexed with mg, po4

Details for d1lajc_

PDB Entry: 1laj, 3.4 Å

PDB Description: The Structure of Tomato Aspermy Virus by X-Ray Crystallography

SCOP Domain Sequences for d1lajc_:

Sequence; same for both SEQRES and ATOM records:

>d1lajc_ b.121.4.5 (C:) Cucumovirus coat protein {TAV (Tomato aspermy virus)}
altqqvnrlaniasssapslqhptfiaskkcragytytsldvrptrtekdksfgqrliip
vpvseypkkkvscvqvrlnpspkfnstiwvslrrldettlltsenvfklftdglavliyq
hvptgiqpnnkitfdmsnvgaeigdmgkyalivyskddvleademvihidiehqripsas
tlpv

Timeline for d1lajc_:

• d1lajc_ first appeared in SCOP 1.63
  
• d1lajc_ appears in SCOP 1.67
  
• d1lajc_ appears in the current release, SCOPe 2.08