SCOP 1.63: Domain d1lajc_: 1laj C:

Lineage for d1lajc_ (1laj C:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (18 proteins)

6. Protein TAV coat protein [82011] (1 species)

7. Species Tomato aspermy virus [TaxId:12315] [82012] (1 PDB entry)

8. Domain d1lajc_: 1laj C: [77867]
   complexed with mg, po4

Details for d1lajc_

PDB Entry: 1laj, 3.4 Å

PDB Description: The Structure of Tomato Aspermy Virus by X-Ray Crystallography

SCOP Domain Sequences for d1lajc_:

Sequence; same for both SEQRES and ATOM records:

>d1lajc_ b.10.1.2 (C:) TAV coat protein {Tomato aspermy virus}
altqqvnrlaniasssapslqhptfiaskkcragytytsldvrptrtekdksfgqrliip
vpvseypkkkvscvqvrlnpspkfnstiwvslrrldettlltsenvfklftdglavliyq
hvptgiqpnnkitfdmsnvgaeigdmgkyalivyskddvleademvihidiehqripsas
tlpv

Timeline for d1lajc_:

• d1lajc_ is new in SCOP 1.63
  
• d1lajc_ appears in SCOP 1.65
  
• d1lajc_ appears in the current release, SCOPe 2.08