SCOP 1.67: Domain d1l8qa2: 1l8q A:77-289

Lineage for d1l8qa2 (1l8q A:77-289)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (18 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Chromosomal replication initiation factor DnaA [82416] (1 species)
   contains TrpR-like DNA-binding domain after the family specific domains

7. Species Aquifex aeolicus [TaxId:63363] [82417] (1 PDB entry)

8. Domain d1l8qa2: 1l8q A:77-289 [77810]
   Other proteins in same PDB: d1l8qa1
   complexed with adp, mg, mse

Details for d1l8qa2

PDB Entry: 1l8q, 2.7 Å

PDB Description: crystal structure of dna replication initiation factor

SCOP Domain Sequences for d1l8qa2:

Sequence; same for both SEQRES and ATOM records:

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus}
dflnpkytlenfivgegnrlayevvkealenlgslynpifiygsvgtgkthllqaagnea
kkrgyrviyssaddfaqamvehlkkgtinefrnmyksvdllllddvqflsgkertqieff
hifntlyllekqiilasdrhpqkldgvsdrlvsrfeggilveieldnktrfkiikeklke
fnlelrkevidyllentknvreiegkikliklk

Timeline for d1l8qa2:

• d1l8qa2 first appeared in SCOP 1.63
  
• d1l8qa2 appears in SCOP 1.65
  
• d1l8qa2 appears in SCOP 1.69
  
• d1l8qa2 appears in the current release, SCOPe 2.08