Lineage for d1l7sh1 (1l7s H:1-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219193Species Anti-testosterone Fab77, (mouse), kappa L chain [81944] (2 PDB entries)
  8. 219196Domain d1l7sh1: 1l7s H:1-118 [77795]
    Other proteins in same PDB: d1l7sh2, d1l7sl2

Details for d1l7sh1

PDB Entry: 1l7s (more details), 2.15 Å

PDB Description: Crystal Structure Analysis of the Anti-testosterone Fab in Complex with Testosterone

SCOP Domain Sequences for d1l7sh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7sh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Anti-testosterone Fab77, (mouse), kappa L chain}
evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvss

SCOP Domain Coordinates for d1l7sh1:

Click to download the PDB-style file with coordinates for d1l7sh1.
(The format of our PDB-style files is described here.)

Timeline for d1l7sh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l7sh2