Lineage for d1l7qa2 (1l7q A:4-351)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842635Family c.69.1.21: PepX catalytic domain-like [69581] (3 proteins)
  6. 842675Protein Bacterial cocaine esterase N-terminal domain [69582] (1 species)
  7. 842676Species Rhodococcus sp. mb1 [TaxId:51612] [69583] (4 PDB entries)
  8. 842680Domain d1l7qa2: 1l7q A:4-351 [77792]
    Other proteins in same PDB: d1l7qa1
    complexed with bez; mutant

Details for d1l7qa2

PDB Entry: 1l7q (more details), 1.76 Å

PDB Description: ser117ala mutant of bacterial cocaine esterase coce
PDB Compounds: (A:) cocaine esterase

SCOP Domain Sequences for d1l7qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7qa2 c.69.1.21 (A:4-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}
gnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwlefv
rdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvaylgvtq
wqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsdarp
edaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislfer
lgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgiaa
typiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdw

SCOP Domain Coordinates for d1l7qa2:

Click to download the PDB-style file with coordinates for d1l7qa2.
(The format of our PDB-style files is described here.)

Timeline for d1l7qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l7qa1