Class b: All beta proteins [48724] (165 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) |
Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins) |
Protein Bacterial cocaine esterase, C-terminal domain [69223] (1 species) |
Species Rhodococcus sp. mb1 [TaxId:51612] [69224] (4 PDB entries) |
Domain d1l7qa1: 1l7q A:352-574 [77791] Other proteins in same PDB: d1l7qa2 complexed with bez; mutant |
PDB Entry: 1l7q (more details), 1.76 Å
SCOP Domain Sequences for d1l7qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l7qa1 b.18.1.13 (A:352-574) Bacterial cocaine esterase, C-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk ydrnsntggviareqleemctavnrihrgpehpshivlpiikr
Timeline for d1l7qa1: