Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain [81956] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [81957] (1 PDB entry) |
Domain d1l6za2: 1l6z A:108-203 [77771] Other proteins in same PDB: d1l6za1 complexed with nag, ndg |
PDB Entry: 1l6z (more details), 3.32 Å
SCOPe Domain Sequences for d1l6za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} qpvtqpflqvtnttvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilri dpikredageyqceisnpvsvrrsnsikldiifdps
Timeline for d1l6za2: