Lineage for d1l6kk_ (1l6k K:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 896267Fold h.6: Apolipoprotein A-II [82935] (1 superfamily)
    segmented tetrameric parallel coiled coil
  4. 896268Superfamily h.6.1: Apolipoprotein A-II [82936] (1 family) (S)
  5. 896269Family h.6.1.1: Apolipoprotein A-II [82937] (1 protein)
  6. 896270Protein Apolipoprotein A-II [82938] (1 species)
  7. 896271Species Human (Homo sapiens) [TaxId:9606] [82939] (2 PDB entries)
  8. 896282Domain d1l6kk_: 1l6k K: [77734]

Details for d1l6kk_

PDB Entry: 1l6k (more details), 2 Å

PDB Description: Structures of Apolipoprotein A-II and a Lipid Surrogate Complex Provide Insights into Apolipoprotein-Lipid Interactions
PDB Compounds: (K:) Apolipoprotein A-II

SCOP Domain Sequences for d1l6kk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6kk_ h.6.1.1 (K:) Apolipoprotein A-II {Human (Homo sapiens) [TaxId: 9606]}
epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnf
lsyfvelgtqpat

SCOP Domain Coordinates for d1l6kk_:

Click to download the PDB-style file with coordinates for d1l6kk_.
(The format of our PDB-style files is described here.)

Timeline for d1l6kk_: