Lineage for d1l5za1 (1l5z A:2-143)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463954Protein Transcriptional regulatory protein DctD, receiver domain [52184] (1 species)
  7. 2463955Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [52185] (3 PDB entries)
  8. 2463957Domain d1l5za1: 1l5z A:2-143 [77722]
    Other proteins in same PDB: d1l5za2
    also includes a part of the linker region
    complexed with gol, so4

Details for d1l5za1

PDB Entry: 1l5z (more details), 2 Å

PDB Description: crystal structure of the e121k substitution of the receiver domain of sinorhizobium meliloti dctd
PDB Compounds: (A:) c4-dicarboxylate transport transcriptional regulatory protein dctd

SCOPe Domain Sequences for d1l5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5za1 c.23.1.1 (A:2-143) Transcriptional regulatory protein DctD, receiver domain {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
saapsvflidddrdlrkamqqtlelagftvssfasatealaglsadfagivisdirmpgm
dglalfrkilaldpdlpmilvtghgdipmavqaiqdgaydfiakpfaadrlvqsarraek
krrlvmenrslrraaeaasegl

SCOPe Domain Coordinates for d1l5za1:

Click to download the PDB-style file with coordinates for d1l5za1.
(The format of our PDB-style files is described here.)

Timeline for d1l5za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l5za2