Lineage for d1l2oc_ (1l2o C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269002Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1269394Protein Myosin Regulatory Chain [47527] (2 species)
  7. 1269395Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (15 PDB entries)
    Uniprot P07291
  8. 1269405Domain d1l2oc_: 1l2o C: [77661]
    Other proteins in same PDB: d1l2oa1, d1l2oa2, d1l2ob_
    complexed with adp, ca, mg, pdm

Details for d1l2oc_

PDB Entry: 1l2o (more details), 2.8 Å

PDB Description: scallop myosin s1-adp-p-pdm in the actin-detached conformation
PDB Compounds: (C:) myosin essential light chain

SCOPe Domain Sequences for d1l2oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2oc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
vdeiikltdlqedlegnvkyedfvkkvmagpyp

SCOPe Domain Coordinates for d1l2oc_:

Click to download the PDB-style file with coordinates for d1l2oc_.
(The format of our PDB-style files is described here.)

Timeline for d1l2oc_: