SCOPe 2.04: Domain d1l2ob_: 1l2o B:

Lineage for d1l2ob_ (1l2o B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Essential Chain [47524] (3 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries)
   Uniprot P13543

8. Domain d1l2ob_: 1l2o B: [77660]
   Other proteins in same PDB: d1l2oa1, d1l2oa2, d1l2oc_
   complexed with adp, ca, mg, pdm

Details for d1l2ob_

PDB Entry: 1l2o, 2.8 Å

PDB Description: scallop myosin s1-adp-p-pdm in the actin-detached conformation

PDB Compounds: (B:) myosin regulatory light chain

SCOPe Domain Sequences for d1l2ob_:

Sequence; same for both SEQRES and ATOM records:

>d1l2ob_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvkftamikgsgee

Timeline for d1l2ob_:

• d1l2ob_ first appeared in SCOP 1.63
  
• d1l2ob_ appears in SCOPe 2.03
  
• d1l2ob_ appears in SCOPe 2.05
  
• d1l2ob_ appears in the current release, SCOPe 2.08