Lineage for d1kx9b_ (1kx9 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 360212Superfamily a.118.21: Chemosensory protein Csp2 [100910] (1 family) (S)
  5. 360213Family a.118.21.1: Chemosensory protein Csp2 [81898] (1 protein)
  6. 360214Protein Chemosensory protein Csp2 [81899] (1 species)
  7. 360215Species Cabbage moth (Mamestra brassicae) [TaxId:55057] [81900] (5 PDB entries)
  8. 360219Domain d1kx9b_: 1kx9 B: [77603]
    complexed with act

Details for d1kx9b_

PDB Entry: 1kx9 (more details), 1.65 Å

PDB Description: antennal chemosensory protein a6 from the moth mamestra brassicae

SCOP Domain Sequences for d1kx9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx9b_ a.118.21.1 (B:) Chemosensory protein Csp2 {Cabbage moth (Mamestra brassicae)}
inldeilankrllvayvncvmergkcspegkelkehlqdaiengckkctenqekgayrvi
ehlikneieiwreltakydptgnwrkkyedrakaagivipee

SCOP Domain Coordinates for d1kx9b_:

Click to download the PDB-style file with coordinates for d1kx9b_.
(The format of our PDB-style files is described here.)

Timeline for d1kx9b_: