Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2B [47119] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (26 PDB entries) |
Domain d1kx4h_: 1kx4 H: [77592] Other proteins in same PDB: d1kx4a_, d1kx4b_, d1kx4c_, d1kx4e_, d1kx4f_, d1kx4g_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 1kx4 (more details), 2.6 Å
SCOPe Domain Sequences for d1kx4h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx4h_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]} trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits reiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d1kx4h_: