SCOP 1.65: Domain d1kwoc_: 1kwo C:

Lineage for d1kwoc_ (1kwo C:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (18 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (10 PDB entries)

8. Domain d1kwoc_: 1kwo C: [77572]
   Other proteins in same PDB: d1kwoa1, d1kwoa2, d1kwob_
   complexed with ags, ca, mg, pdm

Details for d1kwoc_

PDB Entry: 1kwo, 3.8 Å

PDB Description: scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation

SCOP Domain Sequences for d1kwoc_:

Sequence; same for both SEQRES and ATOM records:

>d1kwoc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians)}
klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
vdeiikltdlqedlegnvkyedfvkkvmagpyp

Timeline for d1kwoc_:

• d1kwoc_ first appeared in SCOP 1.63
  
• d1kwoc_ appears in SCOP 1.67
  
• d1kwoc_ appears in the current release, SCOPe 2.08