Lineage for d1kwob_ (1kwo B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213324Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
    Duplication: made with two pairs of EF-hands
  6. 213436Protein Myosin Essential Chain [47524] (2 species)
  7. 213437Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (10 PDB entries)
  8. 213445Domain d1kwob_: 1kwo B: [77571]
    Other proteins in same PDB: d1kwoa1, d1kwoa2, d1kwoc_
    complexed with ags, ca, mg, pdm

Details for d1kwob_

PDB Entry: 1kwo (more details), 3.8 Å

PDB Description: scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation

SCOP Domain Sequences for d1kwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwob_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians)}
pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvkftamikgsgee

SCOP Domain Coordinates for d1kwob_:

Click to download the PDB-style file with coordinates for d1kwob_.
(The format of our PDB-style files is described here.)

Timeline for d1kwob_: