SCOPe 2.05: Domain d1kwoa1: 1kwo A:29-76

Lineage for d1kwoa1 (1kwo A:29-76)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries)
   Uniprot P24733 3-836 ! Uniprot P24733 6-837

8. Domain d1kwoa1: 1kwo A:29-76 [77569]
   Other proteins in same PDB: d1kwoa2, d1kwob_, d1kwoc_
   complexed with ags, ca, mg, pdm

Details for d1kwoa1

PDB Entry: 1kwo, 3.8 Å

PDB Description: scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation

PDB Compounds: (A:) myosin heavy chain

SCOPe Domain Sequences for d1kwoa1:

Sequence; same for both SEQRES and ATOM records:

>d1kwoa1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

Timeline for d1kwoa1:

• d1kwoa1 first appeared in SCOP 1.63
  
• d1kwoa1 appears in SCOPe 2.04
  
• d1kwoa1 appears in SCOPe 2.06
  
• d1kwoa1 appears in the current release, SCOPe 2.08