Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (11 PDB entries) Uniprot P24733 3-836 ! Uniprot P24733 6-837 |
Domain d1kwoa1: 1kwo A:29-76 [77569] Other proteins in same PDB: d1kwoa2, d1kwob_, d1kwoc_ complexed with ags, ca, mg, pdm |
PDB Entry: 1kwo (more details), 3.8 Å
SCOPe Domain Sequences for d1kwoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwoa1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs
Timeline for d1kwoa1: