Lineage for d1kv6b_ (1kv6 B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217490Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 217491Species Human (Homo sapiens) [TaxId:9606] [81917] (1 PDB entry)
  8. 217493Domain d1kv6b_: 1kv6 B: [77547]
    complexed with a co-activator peptide

Details for d1kv6b_

PDB Entry: 1kv6 (more details), 2.7 Å

PDB Description: X-ray structure of the orphan nuclear receptor ERR3 ligand-binding domain in the constitutively active conformation

SCOP Domain Sequences for d1kv6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv6b_ a.123.1.1 (B:) Orphan nuclear receptor ERR3 {Human (Homo sapiens)}
nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea

SCOP Domain Coordinates for d1kv6b_:

Click to download the PDB-style file with coordinates for d1kv6b_.
(The format of our PDB-style files is described here.)

Timeline for d1kv6b_: