SCOP 1.75: Domain d1ksfx3: 1ksf X:437-755

Lineage for d1ksfx3 (1ksf X:437-755)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein ClpA, an Hsp100 chaperone, AAA+ modules [82421] (1 species)
   duplication: two AAA+ modules; the first module is structurally similar to the CDC6 module whereas the second module to the HslU module

7. Species Escherichia coli [TaxId:562] [82422] (2 PDB entries)
   Uniprot Q83LR6

8. Domain d1ksfx3: 1ksf X:437-755 [77524]
   Other proteins in same PDB: d1ksfx1
   complexed with adp, ioh, met, mg, pge; mutant

Details for d1ksfx3

PDB Entry: 1ksf, 2.6 Å

PDB Description: crystal structure of clpa, an hsp100 chaperone and regulator of clpap protease: structural basis of differences in function of the two aaa+ atpase domains

PDB Compounds: (X:) ATP-dependent clp protease ATP-binding subunit clpa

SCOP Domain Sequences for d1ksfx3:

Sequence, based on SEQRES records:

>d1ksfx3 c.37.1.20 (X:437-755) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}
peksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagp
tgvgktevtvqlskalgiellrfdmseymerhtvsrligappgyvgfdqgglltdavikh
phavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvreterks
iglihqdnstdameeikkiftpefrnrldniiwfdhlstdvihqvvdkfivelqvqldqk
gvslevsqearnwlaekgydramgarpmarviqdnlkkplanellfgslvdggqvtvald
kekneltygfqsaqkhkae

Sequence, based on observed residues (ATOM records):

>d1ksfx3 c.37.1.20 (X:437-755) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}
peksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagp
tgvgktevtvqlskalgiellrfdmseymerhtvsrligappgyvgfdqgglltdavikh
phavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvrnstdam
eeikkiftpefrnrldniiwfdhlstdvihqvvdkfivelqvqldqkgvslevsqearnw
laekgydramgarpmarviqdnlkkplanellfgslvdggqvtvaldkekneltygfqsa
qkhkae

Timeline for d1ksfx3:

• d1ksfx3 first appeared in SCOP 1.63
  
• d1ksfx3 appears in SCOP 1.73
  
• d1ksfx3 appears in SCOPe 2.01
  
• d1ksfx3 appears in the current release, SCOPe 2.08