SCOP 1.65: Domain d1kqma1: 1kqm A:29-76

Lineage for d1kqma1 (1kqm A:29-76)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.34: SH3-like barrel [50036] (13 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (8 PDB entries)

8. Domain d1kqma1: 1kqm A:29-76 [77488]
   Other proteins in same PDB: d1kqma2, d1kqmb_, d1kqmc_
   complexed with anp, ca, mg

Details for d1kqma1

PDB Entry: 1kqm, 3 Å

PDB Description: scallop myosin s1-amppnp in the actin-detached conformation

SCOP Domain Sequences for d1kqma1:

Sequence; same for both SEQRES and ATOM records:

>d1kqma1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

Timeline for d1kqma1:

• d1kqma1 first appeared in SCOP 1.63
  
• d1kqma1 appears in SCOP 1.67
  
• d1kqma1 appears in the current release, SCOPe 2.08