SCOP 1.69: Domain d1kprc2: 1kpr C:1-181

Lineage for d1kprc2 (1kpr C:1-181)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (3 PDB entries)

8. Domain d1kprc2: 1kpr C:1-181 [77484]
   Other proteins in same PDB: d1kpra1, d1kprb_, d1kprc1, d1kprd_

Details for d1kprc2

PDB Entry: 1kpr, 2.8 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e

SCOP Domain Sequences for d1kprc2:

Sequence; same for both SEQRES and ATOM records:

>d1kprc2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E}
gshslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseyw
dretrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdgrflrgyeqfaydg
kdyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketll
h

Timeline for d1kprc2:

• d1kprc2 first appeared in SCOP 1.63
  
• d1kprc2 appears in SCOP 1.67
  
• d1kprc2 appears in SCOP 1.71
  
• d1kprc2 appears in the current release, SCOPe 2.08