Lineage for d1kprc1 (1kpr C:182-274)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1106700Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1106899Domain d1kprc1: 1kpr C:182-274 [77483]
    Other proteins in same PDB: d1kpra2, d1kprb_, d1kprc2, d1kprd_
    complexed with so4

Details for d1kprc1

PDB Entry: 1kpr (more details), 2.8 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla- e
PDB Compounds: (C:) hla class I histocompatibility antigen, alpha chain

SCOPe Domain Sequences for d1kprc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kprc1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqaytchvqheglpepvtlrw

SCOPe Domain Coordinates for d1kprc1:

Click to download the PDB-style file with coordinates for d1kprc1.
(The format of our PDB-style files is described here.)

Timeline for d1kprc1: