Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.3: Phycocyanin-like [46532] (4 proteins) oligomers of two different types of homologous subunits each subunit contains 2 additional helices at the N-terminus binds a chromophore |
Protein Allophycocyanin [46537] (3 species) |
Species Red algae (Porphyra yezoensis) [TaxId:2788] [81668] (1 PDB entry) |
Domain d1kn1a_: 1kn1 A: [77455] |
PDB Entry: 1kn1 (more details), 2.2 Å
SCOP Domain Sequences for d1kn1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kn1a_ a.1.1.3 (A:) Allophycocyanin {Red algae (Porphyra yezoensis)} sivtksivnadaearylspgeldriksfvlsgarrvriaqtltenrerivkqagdqlfqk rpdvvspggnaygeemtatclrdldyylrlvtygivsgdvtpieeiglvgvremykslgt pisavaegvkcmksvassllsgedsaeagfyfdyvvgamq
Timeline for d1kn1a_: