Lineage for d1kn0k_ (1kn0 K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946987Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein)
    contains N- and C-terminal extensions to the common fold involved in the oligomerization
  6. 2946988Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species)
    forms an undecameric ring structure; binds to ssDNA and dsDNA
  7. 2946989Species Human (Homo sapiens) [TaxId:9606] [82647] (3 PDB entries)
  8. 2947000Domain d1kn0k_: 1kn0 K: [77454]

Details for d1kn0k_

PDB Entry: 1kn0 (more details), 2.85 Å

PDB Description: Crystal Structure of the human Rad52 protein
PDB Compounds: (K:) Rad52

SCOPe Domain Sequences for d1kn0k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kn0k_ d.50.1.3 (K:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens) [TaxId: 9606]}
cfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyngw
ahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskalslekark
eavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveear
ynsc

SCOPe Domain Coordinates for d1kn0k_:

Click to download the PDB-style file with coordinates for d1kn0k_.
(The format of our PDB-style files is described here.)

Timeline for d1kn0k_: