| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.50: dsRBD-like [54767] (3 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
| Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein) contains N- and C-terminal extentions to the common fold involved in the oligomerisation |
| Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species) forms an undecameric ring structure; binds to ssDNA and dsDNA |
| Species Human (Homo sapiens) [TaxId:9606] [82647] (2 PDB entries) |
| Domain d1kn0g_: 1kn0 G: [77450] |
PDB Entry: 1kn0 (more details), 2.85 Å
SCOP Domain Sequences for d1kn0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kn0g_ d.50.1.3 (G:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens)}
cfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyngw
ahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskalslekark
eavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveear
ynsc
Timeline for d1kn0g_: