Lineage for d1kn0f_ (1kn0 F:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328324Fold d.50: dsRBD-like [54767] (3 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 328325Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 328362Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein)
    contains N- and C-terminal extentions to the common fold involved in the oligomerisation
  6. 328363Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species)
    forms an undecameric ring structure; binds to ssDNA and dsDNA
  7. 328364Species Human (Homo sapiens) [TaxId:9606] [82647] (2 PDB entries)
  8. 328370Domain d1kn0f_: 1kn0 F: [77449]

Details for d1kn0f_

PDB Entry: 1kn0 (more details), 2.85 Å

PDB Description: Crystal Structure of the human Rad52 protein

SCOP Domain Sequences for d1kn0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kn0f_ d.50.1.3 (F:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens)}
cfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyngw
ahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskalslekark
eavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveear
ynsc

SCOP Domain Coordinates for d1kn0f_:

Click to download the PDB-style file with coordinates for d1kn0f_.
(The format of our PDB-style files is described here.)

Timeline for d1kn0f_: