SCOP 1.75: Domain d1kljl_: 1klj L:

Lineage for d1kljl_ (1klj L:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)
   Uniprot P08709 108-202
   Uniprot P08709 107-202
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d1kljl_: 1klj L: [77438]
   Other proteins in same PDB: d1kljh_
   C-terminal domain
   complexed with ca, egl

Details for d1kljl_

PDB Entry: 1klj, 2.44 Å

PDB Description: Crystal structure of uninhibited factor VIIa

PDB Compounds: (L:) factor VIIa

SCOP Domain Sequences for d1kljl_:

Sequence; same for both SEQRES and ATOM records:

>d1kljl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
licvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d1kljl_:

• d1kljl_ first appeared in SCOP 1.63
  
• d1kljl_ appears in SCOP 1.73
  
• d1kljl_ appears in SCOPe 2.01
  
• d1kljl_ appears in the current release, SCOPe 2.08