Lineage for d1kljl_ (1klj L:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747714Protein Coagulation factor VIIa [57201] (1 species)
  7. 747715Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)
  8. 747728Domain d1kljl_: 1klj L: [77438]
    Other proteins in same PDB: d1kljh_
    C-terminal domain
    complexed with ca, egl

Details for d1kljl_

PDB Entry: 1klj (more details), 2.44 Å

PDB Description: Crystal structure of uninhibited factor VIIa
PDB Compounds: (L:) factor VIIa

SCOP Domain Sequences for d1kljl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kljl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
licvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOP Domain Coordinates for d1kljl_:

Click to download the PDB-style file with coordinates for d1kljl_.
(The format of our PDB-style files is described here.)

Timeline for d1kljl_:

747728
d1kljl_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1kljh_