Class g: Small proteins [56992] (79 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (15 PDB entries) |
Domain d1kljl_: 1klj L: [77438] Other proteins in same PDB: d1kljh_ C-terminal domain complexed with ca, egl |
PDB Entry: 1klj (more details), 2.44 Å
SCOP Domain Sequences for d1kljl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kljl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens)} licvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr
Timeline for d1kljl_: