Lineage for d1klil_ (1kli L:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459896Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1459897Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1459906Protein Coagulation factor VIIa [57201] (1 species)
  7. 1459907Species Human (Homo sapiens) [TaxId:9606] [57202] (43 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1459908Domain d1klil_: 1kli L: [77436]
    Other proteins in same PDB: d1klih_
    C-terminal domain
    complexed with ben, ca, gol, so4

Details for d1klil_

PDB Entry: 1kli (more details), 1.69 Å

PDB Description: Cofactor-and substrate-assisted activation of factor VIIa
PDB Compounds: (L:) factor VIIa

SCOPe Domain Sequences for d1klil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klil_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
hkddqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek
r

SCOPe Domain Coordinates for d1klil_:

Click to download the PDB-style file with coordinates for d1klil_.
(The format of our PDB-style files is described here.)

Timeline for d1klil_: