SCOP 1.71: Domain d1kk7z_: 1kk7 Z:

Lineage for d1kk7z_ (1kk7 Z:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (13 PDB entries)

8. Domain d1kk7z_: 1kk7 Z: [77427]
   Other proteins in same PDB: d1kk7a1, d1kk7a2, d1kk7y_
   complexed with ca, mg, so4

Details for d1kk7z_

PDB Entry: 1kk7, 3.2 Å

PDB Description: scallop myosin in the near rigor conformation

SCOP Domain Sequences for d1kk7z_:

Sequence; same for both SEQRES and ATOM records:

>d1kk7z_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians)}
klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
vdeiikltdlqedlegnvkyedfvkkvmagpypd

Timeline for d1kk7z_:

• d1kk7z_ first appeared in SCOP 1.63
  
• d1kk7z_ appears in SCOP 1.69
  
• d1kk7z_ appears in SCOP 1.73
  
• d1kk7z_ appears in the current release, SCOPe 2.08