Class a: All alpha proteins [46456] (284 folds) |
Fold a.174: Double Clp-N motif [81922] (1 superfamily) multihelical; array |
Superfamily a.174.1: Double Clp-N motif [81923] (1 family) duplication: contains two structural repeats of 4-helical motif |
Family a.174.1.1: Double Clp-N motif [81924] (3 proteins) |
Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species) |
Species Escherichia coli [TaxId:562] [81928] (1 PDB entry) |
Domain d1khyb_: 1khy B: [77411] |
PDB Entry: 1khy (more details), 1.95 Å
SCOPe Domain Sequences for d1khyb_:
Sequence, based on SEQRES records: (download)
>d1khyb_ a.174.1.1 (B:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt dinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtl adilkaagattanitqaieq
>d1khyb_ a.174.1.1 (B:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt dinqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaa gattanitqaieq
Timeline for d1khyb_: