Lineage for d1khyb_ (1khy B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1101197Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 1101198Superfamily a.174.1: Double Clp-N motif [81923] (1 family) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 1101199Family a.174.1.1: Double Clp-N motif [81924] (3 proteins)
  6. 1101200Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species)
  7. 1101201Species Escherichia coli [TaxId:562] [81928] (1 PDB entry)
  8. 1101203Domain d1khyb_: 1khy B: [77411]

Details for d1khyb_

PDB Entry: 1khy (more details), 1.95 Å

PDB Description: the crystal structure of clpb n terminal domain, implication to the peptide binding function of clpb
PDB Compounds: (B:) clpb protein

SCOPe Domain Sequences for d1khyb_:

Sequence, based on SEQRES records: (download)

>d1khyb_ a.174.1.1 (B:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]}
ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt
dinqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtl
adilkaagattanitqaieq

Sequence, based on observed residues (ATOM records): (download)

>d1khyb_ a.174.1.1 (B:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]}
ldrltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrt
dinqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaa
gattanitqaieq

SCOPe Domain Coordinates for d1khyb_:

Click to download the PDB-style file with coordinates for d1khyb_.
(The format of our PDB-style files is described here.)

Timeline for d1khyb_: