SCOP 1.73: Domain d1kgce2: 1kgc E:119-247

Lineage for d1kgce2 (1kgc E:119-247)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (16 PDB entries)

8. Domain d1kgce2: 1kgc E:119-247 [77387]
   Other proteins in same PDB: d1kgcd1, d1kgce1
   LC13 clone

Details for d1kgce2

PDB Entry: 1kgc, 1.5 Å

PDB Description: immune receptor

PDB Compounds: (E:) T-cell receptor beta chain

SCOP Domain Sequences for d1kgce2:

Sequence; same for both SEQRES and ATOM records:

>d1kgce2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d1kgce2:

• d1kgce2 first appeared in SCOP 1.63
  
• d1kgce2 appears in SCOP 1.71
  
• d1kgce2 appears in SCOP 1.75
  
• d1kgce2 appears in the current release, SCOPe 2.08