Lineage for d1kgce2 (1kgc E:119-247)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 366220Protein T-cell antigen receptor [49125] (6 species)
  7. 366231Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (11 PDB entries)
  8. 366233Domain d1kgce2: 1kgc E:119-247 [77387]
    Other proteins in same PDB: d1kgcd1, d1kgce1
    LC13 clone

Details for d1kgce2

PDB Entry: 1kgc (more details), 1.5 Å

PDB Description: immune receptor

SCOP Domain Sequences for d1kgce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgce2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOP Domain Coordinates for d1kgce2:

Click to download the PDB-style file with coordinates for d1kgce2.
(The format of our PDB-style files is described here.)

Timeline for d1kgce2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgce1