SCOPe 2.02: Domain d1kgce1: 1kgc E:3-118

Lineage for d1kgce1 (1kgc E:3-118)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d1kgce1: 1kgc E:3-118 [77386]
   Other proteins in same PDB: d1kgcd2, d1kgce2
   LC13 clone

Details for d1kgce1

PDB Entry: 1kgc, 1.5 Å

PDB Description: immune receptor

PDB Compounds: (E:) T-cell receptor beta chain

SCOPe Domain Sequences for d1kgce1:

Sequence; same for both SEQRES and ATOM records:

>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps
drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte

Timeline for d1kgce1:

• d1kgce1 first appeared in SCOP 1.63
  
• d1kgce1 appears in SCOPe 2.01
  
• d1kgce1 appears in SCOPe 2.03
  
• d1kgce1 appears in the current release, SCOPe 2.08