Lineage for d1kgce1 (1kgc E:3-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220318Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 220329Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (10 PDB entries)
  8. 220330Domain d1kgce1: 1kgc E:3-118 [77386]
    Other proteins in same PDB: d1kgcd2, d1kgce2
    LC13 clone

Details for d1kgce1

PDB Entry: 1kgc (more details), 1.5 Å

PDB Description: immune receptor

SCOP Domain Sequences for d1kgce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps
drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte

SCOP Domain Coordinates for d1kgce1:

Click to download the PDB-style file with coordinates for d1kgce1.
(The format of our PDB-style files is described here.)

Timeline for d1kgce1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgce2