SCOPe 2.07: Domain d1kgcd2: 1kgc D:118-206

Lineage for d1kgcd2 (1kgc D:118-206)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d1kgcd2: 1kgc D:118-206 [77385]
   Other proteins in same PDB: d1kgcd1, d1kgce1
   LC13 clone

Details for d1kgcd2

PDB Entry: 1kgc, 1.5 Å

PDB Description: immune receptor

PDB Compounds: (D:) T-cell receptor alpha chain

SCOPe Domain Sequences for d1kgcd2:

Sequence; same for both SEQRES and ATOM records:

>d1kgcd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d1kgcd2:

• d1kgcd2 first appeared in SCOP 1.63
  
• d1kgcd2 appears in SCOPe 2.06
  
• d1kgcd2 appears in the current release, SCOPe 2.08