| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein T-cell antigen receptor [49125] (6 species) |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (8 PDB entries) |
| Domain d1kgcd2: 1kgc D:118-206 [77385] Other proteins in same PDB: d1kgcd1, d1kgce1 LC13 clone |
PDB Entry: 1kgc (more details), 1.5 Å
SCOP Domain Sequences for d1kgcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgcd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps
Timeline for d1kgcd2: