![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (10 PDB entries) |
![]() | Domain d1kgcd1: 1kgc D:2-117 [77384] Other proteins in same PDB: d1kgcd2, d1kgce2 LC13 clone |
PDB Entry: 1kgc (more details), 1.5 Å
SCOP Domain Sequences for d1kgcd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain} kttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrmasl aiaedrksstlilhratlrdaavyycilplaggtsygkltfgqgtiltvhpn
Timeline for d1kgcd1: