Lineage for d1kgcd1 (1kgc D:2-117)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220318Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 220319Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (9 PDB entries)
  8. 220320Domain d1kgcd1: 1kgc D:2-117 [77384]
    Other proteins in same PDB: d1kgcd2, d1kgce2
    LC13 clone

Details for d1kgcd1

PDB Entry: 1kgc (more details), 1.5 Å

PDB Description: immune receptor

SCOP Domain Sequences for d1kgcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
kttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrmasl
aiaedrksstlilhratlrdaavyycilplaggtsygkltfgqgtiltvhpn

SCOP Domain Coordinates for d1kgcd1:

Click to download the PDB-style file with coordinates for d1kgcd1.
(The format of our PDB-style files is described here.)

Timeline for d1kgcd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgcd2