Lineage for d1kfwa1 (1kfw A:10-327,A:389-444)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2094740Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2094910Protein Psychrophilic chitinase B [82249] (1 species)
  7. 2094911Species Arthrobacter sp., tad20 [TaxId:1667] [82250] (1 PDB entry)
  8. 2094912Domain d1kfwa1: 1kfw A:10-327,A:389-444 [77376]
    Other proteins in same PDB: d1kfwa2
    complexed with gol

Details for d1kfwa1

PDB Entry: 1kfw (more details), 1.74 Å

PDB Description: Structure of catalytic domain of psychrophilic chitinase B from Arthrobacter TAD20
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1kfwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]}
pltstvngyrnvgyfaqwgvygrafqakqldvsgtaknlthinysfgninnqtltcfman
kaqgtgpngsdgagdawadfgmgyaadksvsgkadtwdqplagsfnqlkqlkaknpklkv
mislggwtwsknfskaaateasrqklvsscidlyikgnlpnfegrggagaaagifdgidi
dwewpgtnsglagngvdtvndranfkallaefrkqldaygstnnkkyvlsaflpanpadi
daggwddpanfksldfgsiqgydlhgawnptltghqanlyddpadprapskkfsadkavk
kylaagidpkqlglglaaXdniattkqktdyivskglgggmwwelsgdrngelvgamsdk
fraaapgpvteaapp

SCOPe Domain Coordinates for d1kfwa1:

Click to download the PDB-style file with coordinates for d1kfwa1.
(The format of our PDB-style files is described here.)

Timeline for d1kfwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kfwa2