SCOP 1.67: Domain d1kfam2: 1kfa M:113-213

Lineage for d1kfam2 (1kfa M:113-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1kfam2: 1kfa M:113-213 [77368]
   Other proteins in same PDB: d1kfah1, d1kfah2, d1kfai1, d1kfai2, d1kfal1, d1kfam1
   part of anti-gibberellin A4 Fab 4-B8(8)/E9; conflict: annotated in PDB as human protein
   complexed with ga4

Details for d1kfam2

PDB Entry: 1kfa, 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4

SCOP Domain Sequences for d1kfam2:

Sequence; same for both SEQRES and ATOM records:

>d1kfam2 b.1.1.2 (M:113-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radagptvssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhasytceaahktstspiaks

Timeline for d1kfam2:

• d1kfam2 first appeared in SCOP 1.63
  
• d1kfam2 appears in SCOP 1.65
  
• d1kfam2 appears in SCOP 1.69
  
• d1kfam2 appears in the current release, SCOPe 2.08