SCOP 1.73: Domain d1kfam1: 1kfa M:1-112

Lineage for d1kfam1 (1kfa M:1-112)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1kfam1: 1kfa M:1-112 [77367]
   Other proteins in same PDB: d1kfah1, d1kfah2, d1kfai1, d1kfai2, d1kfal2, d1kfam2
   part of anti-gibberellin A4 Fab 4-B8(8)/E9; conflict: annotated in PDB as human protein
   complexed with ga4

Details for d1kfam1

PDB Entry: 1kfa, 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4

PDB Compounds: (M:) monoclonal antibody light chain

SCOP Domain Sequences for d1kfam1:

Sequence; same for both SEQRES and ATOM records:

>d1kfam1 b.1.1.1 (M:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqtplslsvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvssrf
sgfpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleik

Timeline for d1kfam1:

• d1kfam1 first appeared in SCOP 1.63
  
• d1kfam1 appears in SCOP 1.71
  
• d1kfam1 appears in SCOP 1.75
  
• d1kfam1 appears in the current release, SCOPe 2.08