| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
| Domain d1kfal2: 1kfa L:113-217 [77366] Other proteins in same PDB: d1kfah1, d1kfah2, d1kfai1, d1kfai2, d1kfal1, d1kfam1 |
PDB Entry: 1kfa (more details), 2.8 Å
SCOP Domain Sequences for d1kfal2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfal2 b.1.1.2 (L:113-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radagptvssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhasytceaahktstspiaksfnra
Timeline for d1kfal2: