SCOP 1.63: Domain d1kfal2: 1kfa L:113-217

Lineage for d1kfal2 (1kfa L:113-217)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain [81952] (1 PDB entry)

8. Domain d1kfal2: 1kfa L:113-217 [77366]
   Other proteins in same PDB: d1kfah1, d1kfai1, d1kfal1, d1kfam1

Details for d1kfal2

PDB Entry: 1kfa, 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4

SCOP Domain Sequences for d1kfal2:

Sequence; same for both SEQRES and ATOM records:

>d1kfal2 b.1.1.2 (L:113-217) Immunoglobulin (constant domains of L and H chains) {Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain}
radagptvssfppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhasytceaahktstspiaksfnra

Timeline for d1kfal2:

• d1kfal2 is new in SCOP 1.63
  
• d1kfal2 appears in SCOP 1.65
  
• d1kfal2 appears in the current release, SCOPe 2.08